SCOPe 2.08: Domain d1s8ea_: 1s8e A:

Lineage for d1s8ea_ (1s8e A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.4: DNA double-strand break repair nuclease [64427] (1 protein)
   contains C-terminal alpha/beta subdomain

6. Protein Mre11 [64428] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [64429] (5 PDB entries)
   Uniprot Q8U1N9

8. Domain d1s8ea_: 1s8e A: [105368]
   complexed with mn

Details for d1s8ea_

PDB Entry: 1s8e, 2.3 Å

PDB Description: crystal structure of mre11-3

PDB Compounds: (A:) exonuclease putative

SCOPe Domain Sequences for d1s8ea_:

Sequence; same for both SEQRES and ATOM records:

>d1s8ea_ d.159.1.4 (A:) Mre11 {Pyrococcus furiosus [TaxId: 2261]}
mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
lkkaiallqipkehsipvfaiegnlvrtqrgpsvlnlledfglvyvigmrkekveneylt
serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
yvrlnigwrkpfdlteikellnveylkidtwri

Timeline for d1s8ea_:

• d1s8ea_ first appeared in SCOP 1.69
  
• d1s8ea_ appears in SCOPe 2.07