Lineage for d1s8cd_ (1s8c D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011418Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 protein domains)
    automatically mapped to Pfam PF01126
  6. 2011464Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2011465Species Human (Homo sapiens) [TaxId:9606] [48616] (25 PDB entries)
    Uniprot P09601
  8. 2011505Domain d1s8cd_: 1s8c D: [105367]
    complexed with bla

Details for d1s8cd_

PDB Entry: 1s8c (more details), 2.19 Å

PDB Description: Crystal structure of human heme oxygenase in a complex with biliverdine
PDB Compounds: (D:) Heme oxygenase 1

SCOPe Domain Sequences for d1s8cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s8cd_ a.132.1.1 (D:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
qdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernke
spvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepellv
ahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsle
mtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d1s8cd_:

Click to download the PDB-style file with coordinates for d1s8cd_.
(The format of our PDB-style files is described here.)

Timeline for d1s8cd_: