Lineage for d1s8cc_ (1s8c C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544344Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 544345Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 544346Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 544366Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 544367Species Human (Homo sapiens) [TaxId:9606] [48616] (14 PDB entries)
  8. 544392Domain d1s8cc_: 1s8c C: [105366]

Details for d1s8cc_

PDB Entry: 1s8c (more details), 2.19 Å

PDB Description: Crystal structure of human heme oxygenase in a complex with biliverdine

SCOP Domain Sequences for d1s8cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s8cc_ a.132.1.1 (C:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOP Domain Coordinates for d1s8cc_:

Click to download the PDB-style file with coordinates for d1s8cc_.
(The format of our PDB-style files is described here.)

Timeline for d1s8cc_: