SCOP 1.69: Domain d1s8cb_: 1s8c B:

Lineage for d1s8cb_ (1s8c B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (12 PDB entries)

8. Domain d1s8cb_: 1s8c B: [105365]

Details for d1s8cb_

PDB Entry: 1s8c, 2.19 Å

PDB Description: Crystal structure of human heme oxygenase in a complex with biliverdine

SCOP Domain Sequences for d1s8cb_:

Sequence; same for both SEQRES and ATOM records:

>d1s8cb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1s8cb_:

• d1s8cb_ is new in SCOP 1.69
  
• d1s8cb_ appears in SCOP 1.71
  
• d1s8cb_ appears in the current release, SCOPe 2.08