Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins) this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain |
Protein Serine acetyltransferase [110310] (2 species) extra N-terminal all-alpha subdomain belongs to Pfam PF06426 |
Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries) Uniprot P43886 1-241 |
Domain d1s80e1: 1s80 E:2-240 [105362] Other proteins in same PDB: d1s80a2, d1s80b2, d1s80c2, d1s80d2, d1s80e2, d1s80f2 Structural genomics target |
PDB Entry: 1s80 (more details), 2.7 Å
SCOPe Domain Sequences for d1s80e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s80e1 b.81.1.6 (E:2-240) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} tldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislre iieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqnr kslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlggt gkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
Timeline for d1s80e1: