Lineage for d1s80d_ (1s80 D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1557864Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1557865Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1558080Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins)
    this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain
  6. 1558081Protein Serine acetyltransferase [110310] (2 species)
    extra N-terminal all-alpha subdomain belongs to Pfam PF06426
  7. 1558086Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
    Uniprot P43886 1-241
  8. 1558101Domain d1s80d_: 1s80 D: [105361]
    Structural genomics target

Details for d1s80d_

PDB Entry: 1s80 (more details), 2.7 Å

PDB Description: structure of serine acetyltransferase from haemophilis influenzae rd
PDB Compounds: (D:) Serine acetyltransferase

SCOPe Domain Sequences for d1s80d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s80d_ b.81.1.6 (D:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
sltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaisl
reiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnq
nrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlg
gtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpari
v

SCOPe Domain Coordinates for d1s80d_:

Click to download the PDB-style file with coordinates for d1s80d_.
(The format of our PDB-style files is described here.)

Timeline for d1s80d_: