![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (6 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.6: Serine acetyltransferase [110309] (1 protein) this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain |
![]() | Protein Serine acetyltransferase [110310] (2 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries) |
![]() | Domain d1s80c_: 1s80 C: [105360] |
PDB Entry: 1s80 (more details), 2.7 Å
SCOP Domain Sequences for d1s80c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s80c_ b.81.1.6 (C:) Serine acetyltransferase {Haemophilus influenzae} sltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaisl reiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnq nrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlg gtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpari v
Timeline for d1s80c_: