Lineage for d1s7ob_ (1s7o B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 534151Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 534200Family a.4.13.3: YlxM/p13-like [109706] (2 proteins)
    Pfam 04297; UPF0122
    structural and detectable sequence similarity to Sigma4 domain; contains extra C-terminal all-alpha oligomerization subdomain; forms different, helix-swapped dimers
  6. 534205Protein Hypothetical protein SPy1201 [109707] (1 species)
  7. 534206Species Streptococcus pyogenes [TaxId:1314] [109708] (1 PDB entry)
  8. 534208Domain d1s7ob_: 1s7o B: [105355]

Details for d1s7ob_

PDB Entry: 1s7o (more details), 2.31 Å

PDB Description: crystal structure of putative dna binding protein sp_1288 from streptococcus pygenes

SCOP Domain Sequences for d1s7ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ob_ a.4.13.3 (B:) Hypothetical protein SPy1201 {Streptococcus pyogenes}
iektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnikrteki
letyemklhmysdyvvrseifddmiahyphdeylqekisiltsid

SCOP Domain Coordinates for d1s7ob_:

Click to download the PDB-style file with coordinates for d1s7ob_.
(The format of our PDB-style files is described here.)

Timeline for d1s7ob_: