![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) ![]() |
![]() | Family a.4.13.3: YlxM/p13-like (Pfam 04297; UPF0122) [109706] (1 protein) structural and detectable sequence similarity to Sigma4 domain; contains extra C-terminal all-alpha oligomerization subdomain; forms different, helix-swapped dimers |
![]() | Protein Hypothetical protein SPy1201 [109707] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [109708] (1 PDB entry) |
![]() | Domain d1s7ob_: 1s7o B: [105355] |
PDB Entry: 1s7o (more details), 2.31 Å
SCOP Domain Sequences for d1s7ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ob_ a.4.13.3 (B:) Hypothetical protein SPy1201 {Streptococcus pyogenes} iektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnikrteki letyemklhmysdyvvrseifddmiahyphdeylqekisiltsid
Timeline for d1s7ob_: