SCOP 1.71: Domain d1s7oa_: 1s7o A:

Lineage for d1s7oa_ (1s7o A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families)

5. Family a.4.13.3: YlxM/p13-like [109706] (2 proteins)
   Pfam 04297; UPF0122
   structural and detectable sequence similarity to Sigma4 domain; contains extra C-terminal all-alpha oligomerization subdomain; forms different, helix-swapped dimers

6. Protein Hypothetical protein SPy1201 [109707] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [109708] (1 PDB entry)

8. Domain d1s7oa_: 1s7o A: [105354]

Details for d1s7oa_

PDB Entry: 1s7o, 2.31 Å

PDB Description: crystal structure of putative dna binding protein sp_1288 from streptococcus pygenes

SCOP Domain Sequences for d1s7oa_:

Sequence; same for both SEQRES and ATOM records:

>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes}
ektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnikrtekil
etyemklhmysdyvvrseifddmiahyphdeylqekisiltsidnr

Timeline for d1s7oa_:

• d1s7oa_ first appeared in SCOP 1.69
  
• d1s7oa_ appears in SCOP 1.73
  
• d1s7oa_ appears in the current release, SCOPe 2.08