Lineage for d1s7oa_ (1s7o A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695832Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2695928Family a.4.13.3: YlxM/p13-like [109706] (2 proteins)
    Pfam PF04297; UPF0122
    structural and detectable sequence similarity to Sigma4 domain; contains extra C-terminal all-alpha oligomerization subdomain; forms different, helix-swapped dimers
  6. 2695933Protein Hypothetical protein SPy1201 [109707] (1 species)
  7. 2695934Species Streptococcus pyogenes [TaxId:1314] [109708] (1 PDB entry)
    Uniprot P67253
  8. 2695935Domain d1s7oa_: 1s7o A: [105354]
    Structural genomics target

Details for d1s7oa_

PDB Entry: 1s7o (more details), 2.31 Å

PDB Description: crystal structure of putative dna binding protein sp_1288 from streptococcus pygenes
PDB Compounds: (A:) Hypothetical UPF0122 protein SPy1201/SpyM3_0842/SPs1042/spyM18_1152

SCOPe Domain Sequences for d1s7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]}
ektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnikrtekil
etyemklhmysdyvvrseifddmiahyphdeylqekisiltsidnr

SCOPe Domain Coordinates for d1s7oa_:

Click to download the PDB-style file with coordinates for d1s7oa_.
(The format of our PDB-style files is described here.)

Timeline for d1s7oa_: