![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.9: DGPF domain (Pfam 04946) [110962] (1 protein) there is the putative active site cavity in the equivalent location location to the MLI and YciI active sites automatically mapped to Pfam PF03795 |
![]() | Protein Hypothetical protein PA1349 [110963] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [110964] (1 PDB entry) Uniprot Q9I3Z5 |
![]() | Domain d1s7ia1: 1s7i A:7-122 [105353] Other proteins in same PDB: d1s7ia2, d1s7ia3 Structural genomics target |
PDB Entry: 1s7i (more details), 1.8 Å
SCOPe Domain Sequences for d1s7ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ia1 d.58.4.9 (A:7-122) Hypothetical protein PA1349 {Pseudomonas aeruginosa [TaxId: 287]} mkylcliyfdeaklaavpaeelaaivdecmtysdqlgkaghyiashalqsvqtattlrhq ggrlamtdgpfaetkeqlggfylieardlnqalqiaakippgrlgcvevrpvkewe
Timeline for d1s7ia1: