Lineage for d1s7hc_ (1s7h C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505679Superfamily d.58.48: MTH1187/YkoF-like [89957] (2 families) (S)
  5. 505696Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein)
    duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer
  6. 505697Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species)
  7. 505698Species Bacillus subtilis [TaxId:1423] [110989] (1 PDB entry)
  8. 505701Domain d1s7hc_: 1s7h C: [105351]

Details for d1s7hc_

PDB Entry: 1s7h (more details), 2.2 Å

PDB Description: Structural Genomics, 2.2A crystal structure of protein YKOF from Bacillus subtilis

SCOP Domain Sequences for d1s7hc_:

Sequence, based on SEQRES records: (download)

>d1s7hc_ d.58.48.2 (C:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis}
riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd
ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls
ansp

Sequence, based on observed residues (ATOM records): (download)

>d1s7hc_ d.58.48.2 (C:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis}
riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskkrvnedavrglkaeapcqfalypmnepdym
glimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsan
sp

SCOP Domain Coordinates for d1s7hc_:

Click to download the PDB-style file with coordinates for d1s7hc_.
(The format of our PDB-style files is described here.)

Timeline for d1s7hc_: