SCOPe 2.06: Domain d1s7da_: 1s7d A:

Lineage for d1s7da_ (1s7d A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
   bacterial metal-binding, lipocalin-like protein
   automatically mapped to Pfam PF09223

6. Protein Hypothetical protein YodA [101864] (3 species)

7. Species Escherichia coli [TaxId:562] [101865] (6 PDB entries)
   Uniprot P76344

8. Domain d1s7da_: 1s7d A: [105348]
   Structural genomics target
   complexed with zn

Details for d1s7da_

PDB Entry: 1s7d, 2.17 Å

PDB Description: Crystal structure of refined tetragonal crystal of YodA from Escherichia coli

PDB Compounds: (A:) Metal-binding protein yodA

SCOPe Domain Sequences for d1s7da_:

Sequence; same for both SEQRES and ATOM records:

>d1s7da_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 562]}
gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
veemmsh

Timeline for d1s7da_:

• d1s7da_ first appeared in SCOP 1.69
  
• d1s7da_ appears in SCOPe 2.05
  
• d1s7da_ appears in SCOPe 2.07
  
• d1s7da_ appears in the current release, SCOPe 2.08