SCOPe 2.08: Domain d1s7ca2: 1s7c A:149-312

Lineage for d1s7ca2 (1s7c A:149-312)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)

7. Species Escherichia coli [TaxId:562] [55350] (12 PDB entries)
   Uniprot P06977

8. Domain d1s7ca2: 1s7c A:149-312 [105347]
   Other proteins in same PDB: d1s7ca1
   complexed with mes, so4

Details for d1s7ca2

PDB Entry: 1s7c, 2.04 Å

PDB Description: Crystal structure of MES buffer bound form of glyceraldehyde 3-phosphate dehydrogenase from Escherichia coli

PDB Compounds: (A:) Glyceraldehyde 3-phosphate dehydrogenase A

SCOPe Domain Sequences for d1s7ca2:

Sequence; same for both SEQRES and ATOM records:

>d1s7ca2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
scttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipss
tgaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegem
kgvlgyteddvvstdfngevctsvfdakagialndnfvklvswy

Timeline for d1s7ca2:

• d1s7ca2 first appeared in SCOP 1.69
  
• d1s7ca2 appears in SCOPe 2.07