![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species) |
![]() | Species Escherichia coli [TaxId:562] [51802] (7 PDB entries) |
![]() | Domain d1s7ca1: 1s7c A:2-148,A:313-331 [105346] Other proteins in same PDB: d1s7ca2 complexed with mes, so4 |
PDB Entry: 1s7c (more details), 2.04 Å
SCOP Domain Sequences for d1s7ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ca1 c.2.1.3 (A:2-148,A:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli} tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg pskdntpmfvkganfdkyagqdivsnaXdnetgysnkvldliahisk
Timeline for d1s7ca1: