Lineage for d1s72z_ (1s72 Z:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624941Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 624942Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 624943Protein Ribosomal protein L37ae [57831] (1 species)
  7. 624944Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (19 PDB entries)
  8. 624947Domain d1s72z_: 1s72 Z: [105345]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d1s72z_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

SCOP Domain Sequences for d1s72z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72z_ g.41.8.1 (Z:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

SCOP Domain Coordinates for d1s72z_:

Click to download the PDB-style file with coordinates for d1s72z_.
(The format of our PDB-style files is described here.)

Timeline for d1s72z_: