| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) ![]() |
| Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein) contains irregular N-terminal extension to the common fold |
| Protein Ribosomal protein L32e [52044] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries) Uniprot P12736 |
| Domain d1s72y_: 1s72 Y: [105344] Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72z_ complexed with cd, cl, k, mg, na |
PDB Entry: 1s72 (more details), 2.4 Å
SCOPe Domain Sequences for d1s72y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s72y_ c.9.2.1 (Y:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev
Timeline for d1s72y_:
View in 3DDomains from other chains: (mouse over for more information) d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72z_ |