Lineage for d1s72x_ (1s72 X:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720856Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 720857Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 720858Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 720859Protein Ribosomal protein L31e [54577] (1 species)
  7. 720860Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
  8. 720876Domain d1s72x_: 1s72 X: [105343]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72y_, d1s72z_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d1s72x_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d1s72x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72x_ d.29.1.1 (X:) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1s72x_:

Click to download the PDB-style file with coordinates for d1s72x_.
(The format of our PDB-style files is described here.)

Timeline for d1s72x_: