| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.29: Ribosomal protein L31e [54574] (1 superfamily) beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342 |
Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) ![]() |
| Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein) |
| Protein Ribosomal protein L31e [54577] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries) |
| Domain d1s72x_: 1s72 X: [105343] Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72y_, d1s72z_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 1s72 (more details), 2.4 Å
SCOP Domain Sequences for d1s72x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s72x_ d.29.1.1 (X:) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae
Timeline for d1s72x_:
View in 3DDomains from other chains: (mouse over for more information) d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72y_, d1s72z_ |