Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) automatically mapped to Pfam PF00831 |
Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries) Uniprot P10971 |
Domain d1s72v_: 1s72 V: [105341] Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ complexed with cd, cl, k, mg, na |
PDB Entry: 1s72 (more details), 2.4 Å
SCOPe Domain Sequences for d1s72v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s72v_ a.2.2.1 (V:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]} tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq geegd
Timeline for d1s72v_:
View in 3D Domains from other chains: (mouse over for more information) d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ |