Lineage for d1s72v_ (1s72 V:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1077399Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1077416Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 1077417Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1077418Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1077459Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
    Uniprot P10971
  8. 1077464Domain d1s72v_: 1s72 V: [105341]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
    complexed with cd, cl, k, mg, na

Details for d1s72v_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1s72v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72v_ a.2.2.1 (V:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1s72v_:

Click to download the PDB-style file with coordinates for d1s72v_.
(The format of our PDB-style files is described here.)

Timeline for d1s72v_: