Lineage for d1s72u_ (1s72 U:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244274Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1244275Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1244560Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 1244561Protein Ribosomal protein L24e [57750] (1 species)
  7. 1244562Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 1244567Domain d1s72u_: 1s72 U: [105340]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
    complexed with cd, cl, k, mg, na

Details for d1s72u_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d1s72u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72u_ g.39.1.6 (U:) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d1s72u_:

Click to download the PDB-style file with coordinates for d1s72u_.
(The format of our PDB-style files is described here.)

Timeline for d1s72u_: