SCOP 1.73: Domain d1s72q_: 1s72 Q:

Lineage for d1s72q_ (1s72 Q:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L21e [50108] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)

8. Domain d1s72q_: 1s72 Q: [105336]
   Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d1s72q_

PDB Entry: 1s72, 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOP Domain Sequences for d1s72q_:

Sequence; same for both SEQRES and ATOM records:

>d1s72q_ b.34.5.1 (Q:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

Timeline for d1s72q_:

• d1s72q_ first appeared in SCOP 1.69
  
• d1s72q_ appears in SCOP 1.71
  
• d1s72q_ appears in SCOP 1.75
  
• d1s72q_ appears in the current release, SCOPe 2.08