![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein L18 (L18p) [53139] (3 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (19 PDB entries) |
![]() | Domain d1s72n_: 1s72 N: [105333] Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 1s72 (more details), 2.4 Å
SCOP Domain Sequences for d1s72n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s72n_ c.55.4.1 (N:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui} atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll dgdiel
Timeline for d1s72n_:
![]() Domains from other chains: (mouse over for more information) d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ |