Lineage for d1s72k_ (1s72 K:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558970Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 558971Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 558972Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 558973Protein Ribosomal protein L14 [50195] (2 species)
  7. 558974Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (19 PDB entries)
  8. 558977Domain d1s72k_: 1s72 K: [105330]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d1s72k_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

SCOP Domain Sequences for d1s72k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72k_ b.39.1.1 (K:) Ribosomal protein L14 {Archaeon Haloarcula marismortui}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1s72k_:

Click to download the PDB-style file with coordinates for d1s72k_.
(The format of our PDB-style files is described here.)

Timeline for d1s72k_: