Lineage for d1s72j_ (1s72 J:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825308Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 825309Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 825310Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 825311Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 825312Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries)
    Uniprot P29198
  8. 825317Domain d1s72j_: 1s72 J: [105329]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d1s72j_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (J:) 50S ribosomal protein L13P

SCOP Domain Sequences for d1s72j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72j_ c.21.1.1 (J:) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1s72j_:

Click to download the PDB-style file with coordinates for d1s72j_.
(The format of our PDB-style files is described here.)

Timeline for d1s72j_: