SCOPe 2.05: Domain d1s72h_: 1s72 H:

Lineage for d1s72h_ (1s72 H:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families)

5. Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)

6. Protein Ribosomal protein L10e [54688] (2 species)

7. Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
   Uniprot P60617

8. Domain d1s72h_: 1s72 H: [105327]
   Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
   complexed with cd, cl, k, mg, na

Details for d1s72h_

PDB Entry: 1s72, 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

PDB Compounds: (H:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d1s72h_:

Sequence, based on SEQRES records:

>d1s72h_ d.41.4.1 (H:) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscridsspagna

Sequence, based on observed residues (ATOM records):

>d1s72h_ d.41.4.1 (H:) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscridsspagna

Timeline for d1s72h_:

• d1s72h_ first appeared in SCOP 1.69
  
• d1s72h_ appears in SCOPe 2.04
  
• d1s72h_ appears in SCOPe 2.06
  
• d1s72h_ appears in the current release, SCOPe 2.08