Lineage for d1s72h_ (1s72 H:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721795Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 721932Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 721933Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 721934Protein Ribosomal protein L10e [54688] (1 species)
  7. 721935Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (40 PDB entries)
  8. 721951Domain d1s72h_: 1s72 H: [105327]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d1s72h_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (H:) 50S ribosomal protein L10e

SCOP Domain Sequences for d1s72h_:

Sequence, based on SEQRES records: (download)

>d1s72h_ d.41.4.1 (H:) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscridsspagna

Sequence, based on observed residues (ATOM records): (download)

>d1s72h_ d.41.4.1 (H:) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscridsspagna

SCOP Domain Coordinates for d1s72h_:

Click to download the PDB-style file with coordinates for d1s72h_.
(The format of our PDB-style files is described here.)

Timeline for d1s72h_: