![]() | Class j: Peptides [58231] (129 folds) |
![]() | Fold j.84: Ribosomal protein L10 [64658] (1 superfamily) |
![]() | Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) ![]() |
![]() | Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein) |
![]() | Protein Ribosomal protein L10 [64661] (1 species) two alpha-helical segments visible in the crystal structure |
![]() | Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries) Uniprot P15825 |
![]() | Domain d1s72g_: 1s72 G: [105326] Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ complexed with cd, cl, k, mg, na |
PDB Entry: 1s72 (more details), 2.4 Å
SCOPe Domain Sequences for d1s72g_:
Sequence, based on SEQRES records: (download)
>d1s72g_ j.84.1.1 (G:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral dd
>d1s72g_ j.84.1.1 (G:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesrntlleraldd
Timeline for d1s72g_:
![]() Domains from other chains: (mouse over for more information) d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ |