Lineage for d1s72e2 (1s72 E:80-172)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041603Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1041604Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 1041605Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1041606Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1041686Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 1041696Domain d1s72e2: 1s72 E:80-172 [105324]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
    complexed with cd, cl, k, mg, na

Details for d1s72e2

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOPe Domain Sequences for d1s72e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72e2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

SCOPe Domain Coordinates for d1s72e2:

Click to download the PDB-style file with coordinates for d1s72e2.
(The format of our PDB-style files is described here.)

Timeline for d1s72e2: