Lineage for d1s72e1 (1s72 E:1-79)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611499Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 611500Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 611501Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 611502Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 611503Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (19 PDB entries)
  8. 611508Domain d1s72e1: 1s72 E:1-79 [105323]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_

Details for d1s72e1

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (E:)

SCOP Domain Sequences for d1s72e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72e1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1s72e1:

Click to download the PDB-style file with coordinates for d1s72e1.
(The format of our PDB-style files is described here.)

Timeline for d1s72e1: