![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) ![]() |
![]() | Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
![]() | Protein Ribosomal protein L4 [52168] (2 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (19 PDB entries) |
![]() | Domain d1s72c_: 1s72 C: [105321] Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 1s72 (more details), 2.4 Å
SCOP Domain Sequences for d1s72c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s72c_ c.22.1.1 (C:) Ribosomal protein L4 {Archaeon Haloarcula marismortui} mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal aevaer
Timeline for d1s72c_:
![]() Domains from other chains: (mouse over for more information) d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ |