Lineage for d1s72b_ (1s72 B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669499Superfamily b.43.3: Translation proteins [50447] (5 families) (S)
  5. 669648Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 669649Protein Ribosomal protein L3 [50462] (1 species)
    superfamily fold is elaborated with additional structures
  7. 669650Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (40 PDB entries)
  8. 669666Domain d1s72b_: 1s72 B: [105320]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d1s72b_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOP Domain Sequences for d1s72b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72b_ b.43.3.2 (B:) Ribosomal protein L3 {Archaeon Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOP Domain Coordinates for d1s72b_:

Click to download the PDB-style file with coordinates for d1s72b_.
(The format of our PDB-style files is described here.)

Timeline for d1s72b_: