Lineage for d1s72a1 (1s72 A:91-237)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665509Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) (S)
    many known members contain KOW motif
  5. 665631Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 665632Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 665633Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
  8. 665649Domain d1s72a1: 1s72 A:91-237 [105318]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d1s72a1

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d1s72a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72a1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1s72a1:

Click to download the PDB-style file with coordinates for d1s72a1.
(The format of our PDB-style files is described here.)

Timeline for d1s72a1: