Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (19 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein Myosin phosphatase targeting subunit 1, MYPT1 [110891] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [110892] (1 PDB entry) Uniprot Q90623 1-299 |
Domain d1s70b_: 1s70 B: [105317] Other proteins in same PDB: d1s70a_ complexed with mn, pge |
PDB Entry: 1s70 (more details), 2.7 Å
SCOPe Domain Sequences for d1s70b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} mkmadakqkrneqlkrwigsetdleppvvkrkktkvkfddgavflaacssgdteevlrll ergadinyanvdgltalhqaciddnvdmvkflvenganinqpdnegwiplhaaascgyld iaeylisqgahvgavnsegdtpldiaeeeameellqnevnrqgvdieaarkeeerimlrd arqwlnsghindvrhaksggtalhvaaakgytevlklliqarydvnikdydgwtplhaaa hwgkeeacrilvenlcdmeavnkvgqtafdvadedilgyleelqkkqnllh
Timeline for d1s70b_: