Lineage for d1s70b_ (1s70 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515955Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 515956Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 515957Family d.211.1.1: Ankyrin repeat [48404] (15 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 515997Protein Myosin phosphatase targeting subunit 1, MYPT1 [110891] (1 species)
  7. 515998Species Chicken (Gallus gallus) [TaxId:9031] [110892] (1 PDB entry)
  8. 515999Domain d1s70b_: 1s70 B: [105317]
    Other proteins in same PDB: d1s70a_

Details for d1s70b_

PDB Entry: 1s70 (more details), 2.7 Å

PDB Description: complex between protein ser/thr phosphatase-1 (delta) and the myosin phosphatase targeting subunit 1 (mypt1)

SCOP Domain Sequences for d1s70b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus)}
mkmadakqkrneqlkrwigsetdleppvvkrkktkvkfddgavflaacssgdteevlrll
ergadinyanvdgltalhqaciddnvdmvkflvenganinqpdnegwiplhaaascgyld
iaeylisqgahvgavnsegdtpldiaeeeameellqnevnrqgvdieaarkeeerimlrd
arqwlnsghindvrhaksggtalhvaaakgytevlklliqarydvnikdydgwtplhaaa
hwgkeeacrilvenlcdmeavnkvgqtafdvadedilgyleelqkkqnllh

SCOP Domain Coordinates for d1s70b_:

Click to download the PDB-style file with coordinates for d1s70b_.
(The format of our PDB-style files is described here.)

Timeline for d1s70b_: