![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
![]() | Protein Myosin phosphatase targeting subunit 1, MYPT1 [110891] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [110892] (1 PDB entry) Uniprot Q90623 1-299 |
![]() | Domain d1s70b_: 1s70 B: [105317] Other proteins in same PDB: d1s70a_ complexed with mn, pge applies to all domains of a family if the common domain is composed of a different number of small repeating units has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1s70 (more details), 2.7 Å
SCOPe Domain Sequences for d1s70b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} mkmadakqkrneqlkrwigsetdleppvvkrkktkvkfddgavflaacssgdteevlrll ergadinyanvdgltalhqaciddnvdmvkflvenganinqpdnegwiplhaaascgyld iaeylisqgahvgavnsegdtpldiaeeeameellqnevnrqgvdieaarkeeerimlrd arqwlnsghindvrhaksggtalhvaaakgytevlklliqarydvnikdydgwtplhaaa hwgkeeacrilvenlcdmeavnkvgqtafdvadedilgyleelqkkqnllh
Timeline for d1s70b_: