![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
![]() | Protein Protein phosphatase-1 (PP-1) [56311] (6 species) |
![]() | Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (17 PDB entries) Uniprot P37140 1-308 |
![]() | Domain d1s70a_: 1s70 A: [105316] Other proteins in same PDB: d1s70b_ complexed with mn, pge |
PDB Entry: 1s70 (more details), 2.7 Å
SCOPe Domain Sequences for d1s70a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s70a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]} hmadgelnvdslitrllevrgcrpgkivqmteaevrglciksreiflsqpilleleaplk icgdihgqytdllrlfeyggfppeanylflgdyvdrgkqsleticlllaykikypenffl lrgnhecasinriygfydeckrrfniklwktftdcfnclpiaaivdekifcchgglspdl qsmeqirrimrptdvpdtgllcdllwsdpdkdvqgwgendrgvsftfgadvvskflnrhd ldlicrahqvvedgyeffakrqlvtlfsapnycgefdnaggmmsvdetlmcsfqilkpse kkakyqygg
Timeline for d1s70a_: