SCOP 1.71: Domain d1s6sb_: 1s6s B:

Lineage for d1s6sb_ (1s6s B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (179 PDB entries)

8. Domain d1s6sb_: 1s6s B: [105313]
   complexed with 017, cl, na; mutant

Details for d1s6sb_

PDB Entry: 1s6s, 1.53 Å

PDB Description: Crystal Structure Analysis of HIV-1 Protease Mutant I84V with a Potent Non-peptide Inhibitor (UIC-94017)

SCOP Domain Sequences for d1s6sb_:

Sequence; same for both SEQRES and ATOM records:

>d1s6sb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf

Timeline for d1s6sb_:

• d1s6sb_ first appeared in SCOP 1.69
  
• d1s6sb_ does not appear in SCOP 1.73