Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calcium-dependent protein kinase sk5 CLD [109821] (1 species) |
Species Soybean (Glycine max) [TaxId:3847] [109822] (2 PDB entries) Uniprot P28583 328-508 |
Domain d1s6ia_: 1s6i A: [105310] complexed with ca |
PDB Entry: 1s6i (more details)
SCOPe Domain Sequences for d1s6ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} aerlseeeigglkelfkmidtdnsgtitfdelkdglkrvgselmeseikdlmdaadidks gtidygefiaatvhlnklereenlvsafsyfdkdgsgyitldeiqqackdfglddihidd mikeidqdndgqidygefaammrkrkgnggigrrtmrktlnlrdalglvdngsnqviegy fk
Timeline for d1s6ia_: