Lineage for d1s6ia_ (1s6i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710584Protein Calcium-dependent protein kinase sk5 CLD [109821] (1 species)
  7. 2710585Species Soybean (Glycine max) [TaxId:3847] [109822] (2 PDB entries)
    Uniprot P28583 328-508
  8. 2710586Domain d1s6ia_: 1s6i A: [105310]
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1s6ia_

PDB Entry: 1s6i (more details)

PDB Description: ca2+-regulatory region (cld) from soybean calcium-dependent protein kinase-alpha (cdpk) in the presence of ca2+ and the junction domain (jd)
PDB Compounds: (A:) Calcium-dependent protein kinase SK5

SCOPe Domain Sequences for d1s6ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}
aerlseeeigglkelfkmidtdnsgtitfdelkdglkrvgselmeseikdlmdaadidks
gtidygefiaatvhlnklereenlvsafsyfdkdgsgyitldeiqqackdfglddihidd
mikeidqdndgqidygefaammrkrkgnggigrrtmrktlnlrdalglvdngsnqviegy
fk

SCOPe Domain Coordinates for d1s6ia_:

Click to download the PDB-style file with coordinates for d1s6ia_.
(The format of our PDB-style files is described here.)

Timeline for d1s6ia_: