Class a: All alpha proteins [46456] (289 folds) |
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) can be classified as disulfide-rich |
Family a.52.1.3: Seed storage protein, 2S albumin [47715] (3 proteins) two chains result from a single-chain precursor |
Protein Methionine-rich 2S protein (albumin 8) [109847] (1 species) |
Species Common sunflower (Helianthus annuus) [TaxId:4232] [109848] (1 PDB entry) Uniprot P23110 |
Domain d1s6da_: 1s6d A: [105307] |
PDB Entry: 1s6d (more details)
SCOPe Domain Sequences for d1s6da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s6da_ a.52.1.3 (A:) Methionine-rich 2S protein (albumin 8) {Common sunflower (Helianthus annuus) [TaxId: 4232]} pygrgrtesgcyqqmeeaemlnhcgmylmknlgersqvsprmreedhkqlccmqlknlde kcmcpaimmmlnepmwirmrdqvmsmahnlpiecnlmsqpcqm
Timeline for d1s6da_: