Lineage for d1s6da_ (1s6d A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328002Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2328003Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2328081Family a.52.1.3: Seed storage protein, 2S albumin [47715] (3 proteins)
    two chains result from a single-chain precursor
  6. 2328085Protein Methionine-rich 2S protein (albumin 8) [109847] (1 species)
  7. 2328086Species Common sunflower (Helianthus annuus) [TaxId:4232] [109848] (1 PDB entry)
    Uniprot P23110
  8. 2328087Domain d1s6da_: 1s6d A: [105307]

Details for d1s6da_

PDB Entry: 1s6d (more details)

PDB Description: structure in solution of a methionine-rich 2s albumin protein from sunflower seed
PDB Compounds: (A:) Albumin 8

SCOPe Domain Sequences for d1s6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6da_ a.52.1.3 (A:) Methionine-rich 2S protein (albumin 8) {Common sunflower (Helianthus annuus) [TaxId: 4232]}
pygrgrtesgcyqqmeeaemlnhcgmylmknlgersqvsprmreedhkqlccmqlknlde
kcmcpaimmmlnepmwirmrdqvmsmahnlpiecnlmsqpcqm

SCOPe Domain Coordinates for d1s6da_:

Click to download the PDB-style file with coordinates for d1s6da_.
(The format of our PDB-style files is described here.)

Timeline for d1s6da_: