SCOPe 2.08: Domain d1s6da_: 1s6d A:

Lineage for d1s6da_ (1s6d A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.3: Seed storage protein, 2S albumin [47715] (3 proteins)
   two chains result from a single-chain precursor

6. Protein Methionine-rich 2S protein (albumin 8) [109847] (1 species)

7. Species Common sunflower (Helianthus annuus) [TaxId:4232] [109848] (1 PDB entry)
   Uniprot P23110

8. Domain d1s6da_: 1s6d A: [105307]

Details for d1s6da_

PDB Entry: 1s6d

PDB Description: structure in solution of a methionine-rich 2s albumin protein from sunflower seed

PDB Compounds: (A:) Albumin 8

SCOPe Domain Sequences for d1s6da_:

Sequence; same for both SEQRES and ATOM records:

>d1s6da_ a.52.1.3 (A:) Methionine-rich 2S protein (albumin 8) {Common sunflower (Helianthus annuus) [TaxId: 4232]}
pygrgrtesgcyqqmeeaemlnhcgmylmknlgersqvsprmreedhkqlccmqlknlde
kcmcpaimmmlnepmwirmrdqvmsmahnlpiecnlmsqpcqm

Timeline for d1s6da_:

• d1s6da_ first appeared in SCOP 1.69
  
• d1s6da_ appears in SCOPe 2.07