Lineage for d1s6aa_ (1s6a A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436028Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
    lack the first helix (A)
  6. 436029Protein Protozoan/bacterial hemoglobin [46460] (5 species)
  7. 436033Species Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId:1148] [81667] (4 PDB entries)
  8. 436035Domain d1s6aa_: 1s6a A: [105306]

Details for d1s6aa_

PDB Entry: 1s6a (more details), 1.69 Å

PDB Description: The X-ray structure of the cyanobacteria Synechocystis hemoglobin "cyanoglobin" with azide ligand

SCOP Domain Sequences for d1s6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6aa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803}
stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
lnq

SCOP Domain Coordinates for d1s6aa_:

Click to download the PDB-style file with coordinates for d1s6aa_.
(The format of our PDB-style files is described here.)

Timeline for d1s6aa_: