Lineage for d1s67u_ (1s67 U:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509664Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 509742Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 509780Family d.110.3.2: Heme-binding PAS domain [55789] (2 proteins)
  6. 509781Protein Direct oxygen sensor protein, DOS [111118] (1 species)
    Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU
  7. 509782Species Escherichia coli [TaxId:562] [111119] (4 PDB entries)
  8. 509786Domain d1s67u_: 1s67 U: [105304]

Details for d1s67u_

PDB Entry: 1s67 (more details), 1.5 Å

PDB Description: Crystal structure of heme domain of direct oxygen sensor from E. coli

SCOP Domain Sequences for d1s67u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s67u_ d.110.3.2 (U:) Direct oxygen sensor protein, DOS {Escherichia coli}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrdas

SCOP Domain Coordinates for d1s67u_:

Click to download the PDB-style file with coordinates for d1s67u_.
(The format of our PDB-style files is described here.)

Timeline for d1s67u_: