Lineage for d1s67l_ (1s67 L:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037952Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1038114Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1038172Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)
  6. 1038173Protein Direct oxygen sensor protein, DOS [111118] (1 species)
    Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU
  7. 1038174Species Escherichia coli [TaxId:562] [111119] (5 PDB entries)
    Uniprot P76129 8-126 ! Uniprot P76129 12-124
  8. 1038177Domain d1s67l_: 1s67 L: [105303]
    complexed with hem, oxy

Details for d1s67l_

PDB Entry: 1s67 (more details), 1.5 Å

PDB Description: Crystal structure of heme domain of direct oxygen sensor from E. coli
PDB Compounds: (L:) Hypothetical protein yddU

SCOPe Domain Sequences for d1s67l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s67l_ d.110.3.2 (L:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
naadgiffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrp
ahpeyirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrdas

SCOPe Domain Coordinates for d1s67l_:

Click to download the PDB-style file with coordinates for d1s67l_.
(The format of our PDB-style files is described here.)

Timeline for d1s67l_: