Lineage for d1s66u_ (1s66 U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970442Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)
  6. 2970443Protein Direct oxygen sensor protein, DOS [111118] (1 species)
    Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU
  7. 2970444Species Escherichia coli [TaxId:562] [111119] (5 PDB entries)
    Uniprot P76129 8-126 ! Uniprot P76129 12-124
  8. 2970452Domain d1s66u_: 1s66 U: [105302]
    complexed with hem, oxy

Details for d1s66u_

PDB Entry: 1s66 (more details), 1.8 Å

PDB Description: Crystal structure of heme domain of direct oxygen sensor from E. coli
PDB Compounds: (U:) Hypothetical protein yddU

SCOPe Domain Sequences for d1s66u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s66u_ d.110.3.2 (U:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrdas

SCOPe Domain Coordinates for d1s66u_:

Click to download the PDB-style file with coordinates for d1s66u_.
(The format of our PDB-style files is described here.)

Timeline for d1s66u_: