SCOP 1.69: Domain d1s66l_: 1s66 L:

Lineage for d1s66l_ (1s66 L:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.2: Heme-binding PAS domain [55789] (2 proteins)

6. Protein Direct oxygen sensor protein, DOS [111118] (1 species)
   Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU

7. Species Escherichia coli [TaxId:562] [111119] (4 PDB entries)

8. Domain d1s66l_: 1s66 L: [105301]

Details for d1s66l_

PDB Entry: 1s66, 1.8 Å

PDB Description: Crystal structure of heme domain of direct oxygen sensor from E. coli

SCOP Domain Sequences for d1s66l_:

Sequence; same for both SEQRES and ATOM records:

>d1s66l_ d.110.3.2 (L:) Direct oxygen sensor protein, DOS {Escherichia coli}
naadgiffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrp
ahpeyirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrdas

Timeline for d1s66l_:

• d1s66l_ is new in SCOP 1.69
  
• d1s66l_ appears in SCOP 1.71
  
• d1s66l_ appears in the current release, SCOPe 2.08