Lineage for d1s65a_ (1s65 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562942Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 562943Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 562944Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 562960Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 562961Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (179 PDB entries)
  8. 562964Domain d1s65a_: 1s65 A: [105299]

Details for d1s65a_

PDB Entry: 1s65 (more details), 1.1 Å

PDB Description: Crystal Structure Analysis of HIV-1 Protease Mutant V82A with a Potent Non-peptide Inhibitor (UIC-94017)

SCOP Domain Sequences for d1s65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s65a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf

SCOP Domain Coordinates for d1s65a_:

Click to download the PDB-style file with coordinates for d1s65a_.
(The format of our PDB-style files is described here.)

Timeline for d1s65a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s65b_