Lineage for d1s64j_ (1s64 J:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774411Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 774536Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 774537Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 774583Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (29 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 774606Domain d1s64j_: 1s64 J: [105296]
    Other proteins in same PDB: d1s64a_, d1s64c_, d1s64e_, d1s64g_, d1s64i_, d1s64k_

Details for d1s64j_

PDB Entry: 1s64 (more details), 2.55 Å

PDB Description: Rat protein geranylgeranyltransferase type-I complexed with L-778,123 and a sulfate anion
PDB Compounds: (J:) Geranylgeranyl transferase type I beta subunit

SCOP Domain Sequences for d1s64j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s64j_ a.102.4.3 (J:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOP Domain Coordinates for d1s64j_:

Click to download the PDB-style file with coordinates for d1s64j_.
(The format of our PDB-style files is described here.)

Timeline for d1s64j_: